Loading...
Carabidae Carabidae of the World

Carabus (Morphocarabus) rothi hampei Kuster, 1846

Photos
Main (random 10)  |  Main all  |  All  |  Adult  |  Endophallus
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Endophallus
W Ukraine, Vinogradov distr.
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Male adult
W.Ukraine.
Transcarpathian region,Vinogradov distr., near Malaya Kopanya vill., Chorna Gora Mt., h=180m. 7-18.VII.08. Panin R. leg.
male, 28 mm
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei Kuster, 1846 (as ormayi Reitter, 1896) loc.typ.
Carabus (Morphocarabus) rothi hampei Kuster, 1846 (as ormayi Reitter, 1896) loc.typ.
Female adult
W.UKRAINE,
Transcarpathian reg., near Beregovo,15.V-16.VI.2009 Kanarsky Yu. & Geryak Yu. leg.
female, 30 mm
photo/det. Panin R.
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Female adult
Carabus (Morphocarabus) rothi hampei
W Ukraine, Zakarpatian reg., Vinogradov
1.7.1989 Avdeev I. leg.
female, 31 mm
Copyright © Alexander Anichtchenko
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Female adult
arabus (Morphocarabus) rothi hampei
W Ukraine, Zakarpatian reg., Vinogradov
1.7.1989 Avdeev I. leg.
female, 31 mm
Copyright © Alexander Anichtchenko
Carabus (Morphocarabus) rothi hampei Kuster, 1846 (as  dacicus Csiki, 1906)
Carabus (Morphocarabus) rothi hampei Kuster, 1846 (as dacicus Csiki, 1906)
Female adult
NW Romania , Bistrita Nasaud, Beclean env., 17.VI.2009, S.Budka leg.
female, 31 mm
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Carabus (Morphocarabus) rothi hampei Kuster, 1846
Male adult
C Romania, Târgu Mureş, Ernei, 46°35′471″N 24°37’351″E, h=300 m,20.VIII.2004, Sl.Budka leg.
L=30 mm
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei (as hunyadensis Csiki, 1926)
Carabus (Morphocarabus) rothi hampei (as hunyadensis Csiki, 1926)
Male adult
CW Romania, Apuseni Mts, Muntii Metaliferi, Hunedoara reg., near Sacaramb vill., 6.VI.2011, S.Budka leg.
L=37 mm
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei (as gutiiensis Takács & Lie, 1992)
Carabus (Morphocarabus) rothi hampei (as gutiiensis Takács & Lie, 1992)
Endophallus
N Romania, E Carpathian, Maramureş Reg., Gutai Mts, cabana Mogosa, 4 km N Baia Sprie,
Copyright © Ruslan Panin
Carabus (Morphocarabus) rothi hampei (as hunyadensis Csiki, 1926)
Carabus (Morphocarabus) rothi hampei (as hunyadensis Csiki, 1926)
Endophallus
CW Romania, Apuseni Mts, Metalliferous Mt Rng, Hunedoara reg., near Săcărâmb vill.
Copyright © Ruslan Panin
Synonyms
~schaumi Birthler, 1886, nec Gaubil, 1849 "Serbia"(?inexact)
=aurosericeus Kraatz, 1880 "Maros-Vasarhely"(=Tirgu Mures)
=marusii Ormay, 1890 "Gyula-Fehervar & Nagy Enyed" (=Alba Iulia & Aiud)
=ormayi Reitter, 1896 "Beregszasz"(=Beregovo)
=liebli Dietl, 1897 "Komitat Kis-Kukullo"(=Tirnava Mic)
~marginatus Kraatz, 1900; un ?"Maros-Vasarhely" (=Tirgu Mures)
=zoppai Kraatz, 1900 ?"Maros-Vasarhely"(=Tirgu Mures)
=dacicus Csiki, 1906 "Szamosujvar & Naszod"(=Gherla & Bistrita Nasaud)
=eximius Csiki, 1906 "Nagyvarad" (=Oradea)
=fraternus Csiki, 1906 "Maros-Vasarhely" (=Tirgu Mures)
???mendax Csiki, 1906, nec Rossi, 1790 "Komitat Marmaros"(=Maramureş) refers to incompsus, det. Panin R. 2011
~validus Csiki, 1906, nec Kraatz, 1884 "Komitat Hunyad:Nagayg" (=Hunedoara: ca.40km NE Deva: Sacarimb)
~vitiosus Csiki, 1906; un
~zilahiensis Csiki, 1906; un "Komitat Szilagy: Zilah"(=Salaj:Zalau)
=diffinis Csiki, 1906 "Komitat Kolosz"(=Cluj)
~concinnus Lapouge, 1916; un; nom.pro schaumi Birthler "Serbia"(?inexact)
=hunyadensis Csiki, 1926; nom.pro validus Csiki "Komitat Hunyad: Nagayg"(=Hunedoara: ca.40km NE Deva:Sacarimb)
=bokori Csiki, 1927; nom.pro concinnus Lapouge "Serbia"(?inexact)
=telekii Csiki, 1937 ?"Banat"(?inexact)
=gutiiensis Takбcs & Lie, 1992 NW-Romania: NE of Baia Mare: Gutii Mts.
=praedacicus Takбcs & Lie, 1992 C-Romania: WNW of Alba Iulia: Zlatna
Countries and regions
Hungary, Romania, Ukraine
Museums
Description
NW,C,?SW-Romania; NE-Hung.: Szabolcz-Szatmar; W-Ukraine: Beregovo; loc.typ - "Siebenburgen"=Transylvania
Biotope
Genotype
mitochondrial ND5 gene for NADH dehydrogenase subunit 5, partial cds, isolate: 39-00P09.
Reference: Su,Z.H., Imura,Y., Kim,C.G., Okamoto,M. and Osawa,S., 2003. Phylogenetic relationships in the division Lipastromorphi (Coleoptera, Carabidae) of the world as deduced from mitochondrial ND5 gene sequences. Genes Genet. Syst. 78 (1): 37-51

Translation "SSTLVTDGVYLLIRFHLILNENLCLFLLLISTLTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGNYKLAFFHLLTHALFKALLFMCAGAVIH
NLKDTQDIRFMGNLMVHMPLTCICMNISNLALCGMPFLAGFYSKDLILEVVSMDFINIFIYILFFISTGLTVCYSFRLCYYSITGDFNFYSLHSLNDE
GWVMLKSMLSMLLFVIIMGSMLMWLIFPTPVMICLPVELKMMALFVSIIGAWIGYESAKFSVSWFSNSLKFYSYSYFFGF
MWFMPNISTFSMNYIPLMLSYSLYKNFDQGWNEYFGGQGIYNSLKDNSVFLQFLQNNNMKIYLSLIILWMIMLFLILLI"

1 ttcttctaca ttagtaactg atggggttta tttattaatt cgatttcatt taattttaaa
61 tgaaaattta tgtttatttt tattattaat ttctacttta acaatattta tagctgggtt
121 gggcgctaat tttgagtttg atttaaagaa gattattgct ttatctactc taagtcaatt
181 aggattaata ataagaattc tttctatagg aaattataaa ttagcttttt ttcatctttt
241 aactcatgca ttatttaagg ctttattatt tatatgtgct ggggctgtta tccataattt
301 aaaggatacc caagacattc ggtttatagg gaatcttata gttcatatac cattaacttg
361 tatttgtata aatatttcta acttagcatt atgtgggata ccttttttag ctggatttta
421 ttctaaggat ttaattttag aagttgtttc tatagatttt atcaatattt ttatttatat
481 tttatttttt atttctactg gtttgactgt gtgttattct tttcggttat gttattattc
541 tattactggg gattttaatt tttattcttt acattcttta aatgatgaag gttgagttat
601 attaaagagt atattatcaa tgttattatt tgttattatt ataggaagta tattaatatg
661 actaattttt cctacacctg taataatttg tttaccagta gaattaaaaa taatggcatt
721 atttgttaga attattggcg cttgaattgg gtatgaaaga gctaagtttt ctgtcagatg
781 attttctaat tctctaaaat tttatagtta tagatatttt tttggtttta tatgatttat
841 accgaacatt tcgacattta gaataaatta tattccttta atattaagtt atagtctata
901 taaaaatttt gatcaaggtt gaaatgaata ttttgggggt caaggtattt ataatagttt
961 aaaagataat tctgtatttt tacaattttt acaaaataat aatataaaga tttatttatc
1021 tttaattatt ttatgaataa ttatattatt tttgatttta ttaatttaaa atttatattt
1081 aaa
Last revision
03 March 2013 01:34 by Ruslan Panin
Login:
Password:
Register | Forgot your password?
ВКонтакте Facebook Google Accounts Twitter Yandex Mail.ru OpenID WebMoney

Support our efforts

This project help increase the availability of scientific knowledge worldwide. Contributions at any level help sustain our work. Thank you for your support.
Sitemap
Powered by CMS Eleanor © 2017
Page generated in 1.047 seconds. Make queries: 14. Memory: 1.274 MB